DPCstruct | MC2255
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 122 ± 9 aa |
| Standard deviation of domain lengths | 9.19 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 67.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.72 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 46.64 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0G4L5B1 | 1-112 | MDGDPKSSRRTDSDKAPKLIEYRPRSSGDDKEGANAEGQMVVFRPRGDLLLSYVDKGPDSDRGYSMKKALRHFHRERDNSSDSLGRT… |
| A0A366RRG3 | 407-527 | KSKSSKSSSSKSKKSSSSSSKKSHKDKKPQQLIEYRPQSKDGKTEPNEGQVVLYKPRADVFLSFVDKGPESEKGVSLNRVLKRFHRE… |
| A0A2S4PPD3 | 201-316 | None |
| A0A061HJD8 | 65-176 | None |
| A0A507QYZ4 | 299-443 | None |
| A0A0F9XJQ9 | 268-383 | None |
| A0A1Q8RVJ2 | 298-423 | None |
| H1VDY1 | 73-199 | None |
| A0A4Z0ZDS1 | 233-355 | None |
| A0A2S7Y8W6 | 625-745 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.