DPCstruct | MC22549
Metacluster Properties and Pfam Annotations
| Number of structural domains | 112 |
|---|---|
| Mean domain length (aa) | 250 ± 45 aa |
| Standard deviation of domain lengths | 44.81 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 80.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 27.71 |
| Pfam Score | 94.95 |
| Assigned Pfam label(s) | CL0540- PF03909- PF00183- PF15118- CL0207 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2I0K6R3 | 2-200 | RKRLVRKAFDMILGISLSENREDYEKFWDNYGKFLKLGCIEDRDNHKRIAPLLRFFSSQSEEDLISLDEYVENMKSEQKDIYYIAAD… |
| A0A3D0M6Y1 | 35-287 | KERDNYEKYWDDIHPFIKYGCLRDEKFYDRVKDSLIYKSLTQDKFITLSEYLEAAKETHDNKVFYSDDPRQQAQYIALLKGQDMDVL… |
| M1A3V7 | 43-221 | None |
| A0A6I8NVF5 | 46-349 | None |
| W0BEV1 | 68-343 | None |
| K8EXD6 | 887-1202 | None |
| A0A504X6L4 | 252-487 | None |
| A0A5K4FAB9 | 313-614 | None |
| A0A812NC36 | 349-614 | None |
| A0A391NN58 | 14-172 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.