DPCstruct | MC22548
Metacluster Properties and Pfam Annotations
| Number of structural domains | 63 |
|---|---|
| Mean domain length (aa) | 442 ± 75 aa |
| Standard deviation of domain lengths | 74.55 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 76.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 23.84 |
| Pfam Score | 81.62 |
| Assigned Pfam label(s) | CL0260- CL0237- CL0220- CL0072 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7U6QPV2 | 2-330 | STLDAVRPEKQRTTAQETLDFYVPFARLMGLNDIADYIEVLCYRNLDSDMYNKISDKLLQHGLGRNFQREAIHRYLSIVLNNLGLNG… |
| A0A3D0LHA6 | 12-484 | SAEKRYVELIKKIRTYMTADTSLLRDAYDTAMEKHKCSRRKGGAPYITHPLEVAHFCADMKRDNEVIAAALLHDVVEDEDITMTEIG… |
| A2Y0P1 | 50-468 | None |
| A0A287HKV6 | 3-369 | None |
| A0A2P2MT22 | 6-457 | None |
| I4I5X5 | 189-551 | None |
| A0A838RH61 | 2-474 | None |
| A0A2R7S737 | 4-368 | None |
| A3BZA4 | 618-1064 | None |
| A0A484Y2R8 | 7-355 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.