DPCstruct | MC22546
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 219 ± 16 aa |
| Standard deviation of domain lengths | 16.45 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 77.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 44.80 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2I1H1X9 | 255-471 | KVIEELVNKLTSGENTKEIHKEKESKQREMVELQQELSKTSAFYYSNRKKQVLNQANNFLKAKDNFLASREEAIKKLQNCCNNLERF… |
| A0A2P4PJ08 | 41-258 | EIDKELLNKLTSGKNTKEIHKEKEAKHKEMNDLQQELLRTSTSYTVNRKKRVFNQVNNFLKVKGEFLTLREEAIKKLQNCCNHLESS… |
| A0A015KGU8 | 52-282 | None |
| A0A015JWM3 | 1-196 | None |
| A0A2N0R712 | 301-531 | None |
| A0A2I1GRM2 | 592-838 | None |
| A0A2I1GED9 | 72-273 | None |
| A0A2I1H1A1 | 3-214 | None |
| A0A2N1NVD0 | 511-732 | None |
| A0A2I1EBD6 | 872-1096 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.