DPCstruct | MC22543
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 184 ± 19 aa |
| Standard deviation of domain lengths | 18.66 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 70.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 29.42 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2Z6RLP7 | 36-226 | DLLLSEYLDNTSISQSERTIDSRREVLWKLIEDLVIVFDMIDPLSYEIFKDLEPPELHKEGYEGLVACYKNGLERMQVIYKQDVIKI… |
| A0A2P4NU40 | 3-203 | LLFNEFIGDIAVSKKDRAVNGRRELFWALVNSLLVAFESSNPTNHPLFQNCIELTDSGYTKLFSCYDKGKERLKQIYRQEVLRIDPI… |
| A0A397JIN4 | 167-387 | None |
| A0A397IYQ1 | 661-840 | None |
| A0A397IKP9 | 1-174 | None |
| A0A372Q521 | 116-312 | None |
| A0A2N0QUT8 | 622-783 | None |
| A0A2N0QLW0 | 2-190 | None |
| A0A397JNY1 | 235-420 | None |
| U9UVT0 | 189-389 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.