DPCstruct | MC22541
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 323 ± 33 aa |
| Standard deviation of domain lengths | 33.00 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 74.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 30.48 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A372QGQ6 | 1-274 | MAKNLHKLLLYFDNLPTIPPTMNPNNIDVKLYIKKLLEKLRTLTKEEFEAEIENQNNKDFLKVNYSEEKEEKVVIDFQNELNFPEII… |
| A0A2H5UDV3 | 3-336 | ELEIRSLNISNSNAILENNDIGIFRIHFGENDFNEIDEEEVDSKKQSITIKNKKKPFLSSPAITMARNLRELLLNIDKLPDQQSFMM… |
| A0A2H5R8U8 | 43-347 | None |
| A0A2H5RWZ8 | 32-283 | None |
| A0A2H5T286 | 162-541 | None |
| A0A2Z6RC77 | 100-446 | None |
| A0A2Z6QMH4 | 4-355 | None |
| A0A2P4P8S1 | 263-595 | None |
| A0A2H5UBQ3 | 2-311 | None |
| A0A2I1FKB4 | 148-474 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.