DPCstruct | MC22540
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 155 ± 32 aa |
| Standard deviation of domain lengths | 32.26 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 75.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 25.39 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H5U7E4 | 1-150 | MSYLLSRDLTGFNPRSIPDTQMKRKLIEASIPNPQRFIQYYLEMMWPDNCDTLEIPCTNFYSTYQNWCSEKGENKTLSDNKFGMDIK… |
| A0A6A3IN35 | 176-293 | WLLRRDITKFNIRNLPETNYKKLLKCKQSNVGVRFLLNKRQQLIDADTDFEQLYTNKDLYAEYVRWTEESNQKLVNDSTFLQMLDSV… |
| U9UZA9 | 1-191 | None |
| A0A2N1NJT7 | 1-147 | None |
| A0A5J4V312 | 115-228 | None |
| A0A2I1F714 | 783-972 | None |
| A0A397JL46 | 58-171 | None |
| G4ZM77 | 330-444 | None |
| A0A5J4R0F6 | 32-143 | None |
| A0A6A3ZW61 | 176-314 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.