DPCstruct | MC2254
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 127 ± 11 aa |
| Standard deviation of domain lengths | 11.20 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 84.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 30.64 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A1D0R1 | 196-338 | STTKIEAILYKLEETYRQPASEVPRLSLWKPYLNLAMLYATHEQPQKTIEFALKTLESLGYVVEGGHLPHTSGTPLLVKQWGFMTDG… |
| A0A094BBQ3 | 8-139 | IDVQKAERLIAAAEATYKTGPVNAPRESLCGLQLMVARVHKNRGEPAKVIRAALKVLKLLGFEVKGAQVPRGRDEFEVVRWGLMAHG… |
| A0A1Q5SRM0 | 1-131 | None |
| A0A4T0W806 | 2-146 | None |
| A0A093ZRS0 | 462-589 | None |
| Q2GXJ7 | 350-474 | None |
| A0A395T3U4 | 181-317 | None |
| H1VMM7 | 124-252 | None |
| A0A317X8P1 | 519-646 | None |
| A0A3M2TH51 | 1-112 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.