DPCstruct | MC22531
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 126 ± 24 aa |
| Standard deviation of domain lengths | 23.79 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 81.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 27.34 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I6EZQ9 | 79-189 | LRPPKWSREELILACSQLFSNNQVAQRVNDPAVQELAAFLRQLPFHAPQDRGLNFRSGNSVQRKLFDLKTRLPDETGKKTRGGALDQ… |
| A0A2T0RNK9 | 1-125 | MKNPNWLREELILALDLYFKLSFGQMDGRNPLVKSLSEELKALGLHQYIPDTVSFRSPNSVSLKLANFKSFDPGRSGTGMEGSGLLD… |
| A0A1I9ZFC1 | 3-141 | None |
| A0A1E1F5I5 | 70-179 | None |
| A0A6L8A0Z7 | 94-201 | None |
| A0A1H8YCB9 | 328-460 | None |
| A0A2V3PRA0 | 1-121 | None |
| A0A6P0T9M7 | 197-384 | None |
| A0A0V8HTZ5 | 2-99 | None |
| A0A349YMN1 | 2-130 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.