DPCstruct | MC2253
Metacluster Properties and Pfam Annotations
| Number of structural domains | 68 |
|---|---|
| Mean domain length (aa) | 135 ± 18 aa |
| Standard deviation of domain lengths | 17.68 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 78.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 32.48 |
| Pfam Score | 96.67 |
| Assigned Pfam label(s) | PF06331- PF03311- CL0229- CL0219 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P6E591 | 4-132 | VWTWIISFLILITLVGFIVYQLICLADLEFDYINPYDSASRINFVVLPEFFLQGFLCFFYLVTGHWFMALLGVPYLYYNFQLYSKRQ… |
| A0A094APK8 | 511-642 | SGEAWLYLLAVIINAVNLFLQVFFTIMYSDLECDYINPIDLCNRLNTYIIPEAAVHGFLTFLFLINGYWVALILNLPLVAYNVNKIV… |
| A0A3S3QBM6 | 83-221 | None |
| A0A146F1M4 | 4-144 | None |
| A0A803JF51 | 5-159 | None |
| A0A7R9KTT8 | 4-152 | None |
| A0A7R9KMQ9 | 6-143 | None |
| A0A286XE23 | 19-145 | None |
| G3JIA4 | 773-904 | None |
| A0A7C9E1S1 | 65-198 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.