DPCstruct | MC22529
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 170 ± 22 aa |
| Standard deviation of domain lengths | 21.83 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 87.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 21.44 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0631 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T0HTL0 | 125-301 | QRAIDAGDSHAGCSVHIVTAELDDGPVLAQTPVAILPGDSADSLAARILIAEHQLYSRTLAAFVTREQQPEWMLNRVREIALALPQA… |
| F9ERZ0 | 2-163 | KRFKEFGFKLIDNSYYYHTSLLKNQFKMTVKINLDNSIFTEIIDTETNEPYVLYLIEKRSGYSEKVYKAYSEVLEKIKKKCFEDEIF… |
| I0SJ13 | 2-181 | None |
| F4LLW1 | 14-176 | None |
| C8NGR9 | 19-159 | None |
| W0GQJ8 | 3-135 | None |
| R9LTE7 | 13-199 | None |
| A0A4Y9FDX1 | 1-187 | None |
| A0A0B6FQB7 | 97-311 | None |
| R7MZB4 | 17-147 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.