DPCstruct | MC22526
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 94 ± 15 aa |
| Standard deviation of domain lengths | 14.73 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 79.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.54 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 41.76 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05103 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N7T9X6 | 1-73 | MTPHEVRTRSFDPRRRGVDPDQVRQFQARVADDLADLHRQIRSLAEENERLKRALRDWQTMHARECRPANDGH |
| A0A1H3I1S8 | 4-114 | FTRALARLRTAHDPHRHSGEEIPHGVYGGRRSQRVLPGEVRRKRFRPTRLGRRGLDPEEVHHFLNRVAEEMNALYRDLAVSEEQAAR… |
| A0A3N1A6U9 | 17-127 | None |
| A0A1C4YF76 | 10-86 | None |
| A0A246REM4 | 50-166 | None |
| A0A542XJ50 | 21-88 | None |
| A0A4Q7WAJ2 | 4-113 | None |
| A0A1C6TGH7 | 64-162 | None |
| A0A1C6RPX6 | 1-90 | None |
| A0A3N1B0W1 | 17-120 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.