DPCstruct | MC2252
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 95 ± 11 aa |
| Standard deviation of domain lengths | 11.25 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 86.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 39.52 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A094BG44 | 4-86 | DISPHLVTSDNPAGETGALDYHRCALLHNFLVEYGWVASGRSLADLERRSFFEHYGDEANEMRERLEPGLIAFLEEAYVVQRS |
| A0A094AJR9 | 7-111 | NETTWRVTPENPVREVNGMDWERCAALHNLIPRHGWASGGKPESEMPRETWWQTHITDSALEAEWSARLSPTLKQFFQAACEEAPGQ… |
| A0A1B8FK43 | 1-94 | None |
| A0A093XKX9 | 1-106 | None |
| A0A6A6GB98 | 28-117 | None |
| A0A1B8CU64 | 1-113 | None |
| A0A2G7FJM3 | 1-105 | None |
| A0A4S9Y1W0 | 8-82 | None |
| A0A4S8VAU5 | 1-98 | None |
| A0A1X7S471 | 261-344 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.