DPCstruct | MC22516
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 299 ± 23 aa |
| Standard deviation of domain lengths | 23.45 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 85.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.54 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 24.89 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A819D350 | 164-477 | PEIKIDENGTTLNVVGRTIFLSSIKKKIESMMQGTTILQVDIVARDVFHIDTDLEGKDWQGKNLCVVTEKVNVWGDRIIDVSGSGYA… |
| A0A226D9A7 | 3-329 | SIYTTFVNQQHALIVHSPFLEISQCLNHVEEIMVRNSKAGQPIVNVCFIAKEELQIDENLRQYYWHGKNVIIISKTVKVTKPCEWNM… |
| A0A817QUR2 | 2-267 | None |
| A0A816CV60 | 9-290 | None |
| A0A815U172 | 3-348 | None |
| E9G5Q8 | 336-644 | None |
| A0A817Q605 | 222-513 | None |
| A0A164T1G6 | 126-383 | None |
| A0A225WQG1 | 190-505 | None |
| Q23FS3 | 454-738 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.