DPCstruct | MC22515
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 122 ± 21 aa |
| Standard deviation of domain lengths | 21.44 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 77.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 27.73 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6S7I8X5 | 1-85 | MTVCADTLCKRYVPIGASREQNTIYEQICHDGCGISGGPLEVTNNEQFRGCAAKDNNGTCKHCRHDYRVHMHMTYTVSVVEKEFL |
| A0A226D7Q9 | 3-129 | NLNEPRTVCTASSCVEYVDVKGIKECKYKSHCHTNCGTGKEKHFKIANIVGHKNLRKCSAFNSDGMCKRCNCSWQVHMKITYETFIV… |
| A0A814N6D9 | 284-426 | None |
| A0A815UFK5 | 3-117 | None |
| A0A2A2KPS7 | 809-911 | None |
| A0A2B4S3Y1 | 202-299 | None |
| A0A7M5WX49 | 244-380 | None |
| A0A183BVW2 | 279-427 | None |
| A0A820FDY3 | 1-141 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.