DPCstruct | MC22514
Metacluster Properties and Pfam Annotations
| Number of structural domains | 142 |
|---|---|
| Mean domain length (aa) | 150 ± 21 aa |
| Standard deviation of domain lengths | 20.52 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 84.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.43 |
| Mean intra-cluster sequence similarity (%) | 11.48 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4T0UZU2 | 5-177 | VVGELYDPTRTSWPHTDQLRLGPRLTELVRFVPGVSAEEVHQHRYGPLAMAAVDLRPFQLVVAFKFGEEPWCDTPFEAHRLNADLRG… |
| A0A6N9AVT5 | 7-165 | SVTCLPVSFDAGNWETAIFFQIGGGESKQDRRNLTRLGDGVVPVAIESDVIKHESASVVVIRLEVFTRGDDNPLTGEVLLTPGETES… |
| A0A521UAC3 | 4-138 | None |
| A0A7X7D577 | 6-155 | None |
| A0A2N5K9Z3 | 58-215 | None |
| A0A2N5C3D9 | 1-154 | None |
| A0A3P5XW42 | 30-193 | None |
| A0A533U9T4 | 11-148 | None |
| A0A285TM05 | 156-317 | None |
| A0A7W5FGR7 | 57-214 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.