DPCstruct | MC22512
Metacluster Properties and Pfam Annotations
| Number of structural domains | 163 |
|---|---|
| Mean domain length (aa) | 106 ± 17 aa |
| Standard deviation of domain lengths | 16.51 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 89.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 26.40 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14216 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0F9M6M0 | 6-92 | NKTIVVNRHYKAYDVYIGRGTKFGNNYQIGPDGTREEVIAKHKKDFYDNPELQEAVWIELRGRRIGCSCKPLACHGDTYVEYIENRE |
| A0A6N8X859 | 23-129 | LQAGGAKVLNLRHIPGDTSAAALLQRGIVRVDRTTPWGNPFPISTRFGNRDDVIERYRRDLWRRIRSGELPLDELAAIANMPLACWC… |
| A0A820JIW1 | 2-64 | None |
| A0A842MN74 | 14-94 | None |
| A0A813BJZ7 | 285-394 | None |
| A0A6G6Y4W3 | 2-100 | None |
| A0A0F9URI5 | 6-111 | None |
| F4PPY0 | 43-154 | None |
| A0A1Q9SRC1 | 1-100 | None |
| A0A1H1ZT68 | 117-228 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.