DPCstruct | MC2251
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 458 ± 87 aa |
| Standard deviation of domain lengths | 87.00 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 74.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 17.42 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1C1CTA5 | 10-479 | ESVTIPTATLRKLSGSRVDPYTRYVAYRLFKDLNIPSQGGRNINSALSNLPVHLSVAPDEKLSFGWGLSNVIRDKAVHEGSYEHLAM… |
| A0A094A8Z8 | 31-430 | LNLARDLQKSGSDIVVEADLAEVFGRNRIEPRFESTYRTAVKESYTQQLHSLLDIVLEAGAGPTVRRSLTNQAYFSTVVQLSLLTSM… |
| A0A370TDV4 | 1-457 | None |
| A0A3D8T4D9 | 36-339 | None |
| A0A2B7YPI6 | 22-466 | None |
| A0A1V8UWW8 | 1-516 | None |
| A0A6A5WKX2 | 2-526 | None |
| C9SP84 | 87-536 | None |
| A0A093X4U7 | 162-682 | None |
| A0A0C3CVC7 | 1-511 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.