DPCstruct | MC22508
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 149 ± 23 aa |
| Standard deviation of domain lengths | 22.77 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 77.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 34.20 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A518D754 | 511-626 | LREWAGPNSAGRCATCHSLQRQGDHLAFGWRPHDRTTEARGFTRFSHRPHLVQPELRDCRHCHQIDTGAEVSASYASLDPAVFVSEF… |
| A0A7Z9K2Y8 | 13-160 | EGNNKVEPGWATDIFEELANAKGPGVCIKCHSIDQSDNANVSINWRGARPDPNQHSFTKYSHESHFSLLDEKGCVTCHIVNKESDFS… |
| A0A3D1XQA9 | 242-428 | None |
| A0A7T7YEL1 | 682-809 | None |
| A0A7V2AM72 | 223-349 | None |
| A0A1Z7Z6R0 | 267-398 | None |
| A0A2E4UPC7 | 213-384 | None |
| A0A836QRR9 | 442-632 | None |
| A0A7Z9FCP8 | 128-287 | None |
| A0A2D8PQF7 | 318-496 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.