DPCstruct | MC22500
Metacluster Properties and Pfam Annotations
| Number of structural domains | 65 |
|---|---|
| Mean domain length (aa) | 96 ± 19 aa |
| Standard deviation of domain lengths | 18.57 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 85.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 36.32 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03323 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N9PY75 | 237-320 | SGYIEEQIQDNIYSPFPQFRYSERPDTVSAALLQGKFAIIVDGTPNVLIAPTIFLNLIQASEDYYERFIVATAIRWLRFLFLFL |
| A0A2S0JLH6 | 8-104 | SITDISILKQLIEDNPLSPFPQYYMTVRPDSVSQYLIDGRIAVYMDNSQSAIICPTSFFEMFILIEDYYNRWTTASLLRVLRFFGFF… |
| A0A6H1PBS9 | 5-79 | None |
| A0A841TGZ4 | 15-116 | None |
| A0A3B0BDB7 | 51-123 | None |
| R6Y759 | 286-387 | None |
| A0A2C1C624 | 191-273 | None |
| A0A800MSU2 | 2-70 | None |
| A0A5C8MC43 | 201-314 | None |
| S0FXJ1 | 313-396 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.