DPCstruct | MC22499
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 123 ± 22 aa |
| Standard deviation of domain lengths | 22.28 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 88.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 18.38 |
| Pfam Score | 87.50 |
| Assigned Pfam label(s) | PF17415- CL0021 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q64RD4 | 2-151 | TTNAPVGSLSFASGYSTVAPFQFSENTIVLPVLYRVKNVTTTEDIKNELAKHTFTLVCYTDDIKSGDTILKLYLRYKVEDEPAAIAE… |
| A0A7C2WB46 | 161-279 | KIKEIIITKGDFKRNPYSINHIEIENDTLKLIISYSGGCREHEFNLIWNGAFLESYPPKIELFLSHDSKDDHCEAFLTKTLYFDLKS… |
| A0A2A5XKW8 | 2-91 | None |
| A0A849WYK3 | 18-114 | None |
| A0A354CYE4 | 41-150 | None |
| A0A1V5HIH6 | 28-144 | None |
| A0A7C8DEC7 | 211-336 | None |
| A0A1H6RNV6 | 23-159 | None |
| R5TYU6 | 157-275 | None |
| A0A7X3UT10 | 10-147 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.