DPCstruct | MC22493
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 160 ± 18 aa |
| Standard deviation of domain lengths | 17.81 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 79.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 29.07 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A497RTL4 | 33-191 | IGNVSAVFESYVCDDGTSSGNNKCGDGRTPTVMCDTGPTGNCPVICAAECGSATGCITEYCKSCCAAGICKKYPDPSDELNACLSSC… |
| A0A497S3V8 | 119-270 | CTGVCHGREITEEAVKYHGYFGGEDMEIECCRTCKEIWGQACGGYANCVRDEKGCESCCTKWCSDIDDEDAKKQCEITCAANCRNYR… |
| A0A256ZQQ5 | 322-462 | None |
| A0A256ZJQ2 | 354-574 | None |
| A0A256XH34 | 39-203 | None |
| A0A256XGI2 | 15-173 | None |
| A0A7C0XU34 | 2-176 | None |
| A0A497SBI1 | 28-180 | None |
| A0A497S955 | 25-177 | None |
| A0A256XHN1 | 14-171 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.