DPCstruct | MC22491
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 131 ± 16 aa |
| Standard deviation of domain lengths | 15.96 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 82.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.14 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 61.20 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2D0QI38 | 158-294 | SIQFLLNLSIAAVDCKSDKGESFTELLASACSYNTFPFGEEYGFQEEQSDFLLDLYSRVKQYESETGRRVLPALLPVYQSVPAVWSI… |
| A0A7J6DBM3 | 1-133 | MFPSHSSHPYCQLVETDKDAGTRFLTQLSSVCSYKTFPFNYNRHDQSDFLLDLCSHVKYYETQTGRSYLPALQSVFQSPDVWIIDLS… |
| A0A6A5F286 | 4-158 | None |
| A0A1S3Q421 | 286-396 | None |
| A0A674DG97 | 935-1069 | None |
| A0A7J6ACW6 | 394-531 | None |
| A0A3B3QBS2 | 380-520 | None |
| A0A2I4AM06 | 2-156 | None |
| A0A498P1Y9 | 274-404 | None |
| A0A5N5JI95 | 3-96 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.