DPCstruct | MC22489
Metacluster Properties and Pfam Annotations
| Number of structural domains | 122 |
|---|---|
| Mean domain length (aa) | 124 ± 26 aa |
| Standard deviation of domain lengths | 26.45 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 83.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 16.14 |
| Pfam Score | 98.81 |
| Assigned Pfam label(s) | PF01544- CL0436 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A357WWR4 | 3-116 | AYYKTINGRIRPIDELEDGCWIDVVNPDEKEINFLITRFSLEPDFLRASLDEEESSRIECEDDNTLIIIDTPVSEITETGVIYYTMP… |
| A0A6S5Z4R4 | 10-129 | YALTLDGKGGMAPLTAGSEIPGDRPGWLHLDYGHPDSARWLLQTPLLGEAAKESLLGQSNRPKLVRMGETVLLILRGINHNKDHRPE… |
| A0A1H2CEL8 | 218-359 | None |
| A0A1C6L7B3 | 2-84 | None |
| A0A6G3V9Y1 | 2-110 | None |
| A0A2T2UVQ7 | 23-121 | None |
| A0A0S4JKD2 | 171-283 | None |
| A0A6A3NBF7 | 541-755 | None |
| T2RER0 | 13-113 | None |
| A0A2A2K3C1 | 4-125 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.