DPCstruct | MC22488
Metacluster Properties and Pfam Annotations
| Number of structural domains | 63 |
|---|---|
| Mean domain length (aa) | 101 ± 13 aa |
| Standard deviation of domain lengths | 13.46 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 90.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 35.59 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3Q2LRH6 | 256-357 | TGKPISQGGIHGRISATGRGLFHGIENFINEASYMSILGMTPGFGDKTFVVQGFGNVGLHSMRYLHRFGAKCIAVGESDGSIWNPDG… |
| S3HJW6 | 1-84 | MGNFTSALLRKFHPALTQAGLRRVVPIEGARVAVQGFGNVGGIAARLFEQAGARIVALQDHSATLVDEAGINVLAAGEHVGRTG |
| A0A812QV07 | 809-933 | None |
| A0A4Y1R263 | 96-191 | None |
| A0A380DP07 | 213-296 | None |
| R9A988 | 366-461 | None |
| L9KGD0 | 23-124 | None |
| A0A101RM06 | 60-136 | None |
| A0A0G1R9L8 | 174-257 | None |
| A0A101ER55 | 144-229 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.