DPCstruct | MC22480
Metacluster Properties and Pfam Annotations
| Number of structural domains | 52 |
|---|---|
| Mean domain length (aa) | 82 ± 17 aa |
| Standard deviation of domain lengths | 17.49 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 68.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 52.02 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00428 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I7XQ74 | 1-85 | MKYLGAYLLANLGGNDSPSAQDILKILGAGGLDCDMEDATKVVESLSGKNISEVITEGKKKLSSVPSGGSPSGSAAPVAASTAPK |
| A0A660KQQ2 | 1-52 | MKVVAAYLLAVLGGNTSPSAEDVKNILGSVGAEADEDRIELFLCEVKGYGLQ |
| A0A445IJ59 | 136-239 | None |
| A0A3Q7E9G4 | 884-934 | None |
| I7J968 | 2-108 | None |
| A0A6G1DUB7 | 23-83 | None |
| A0A3N4JVF8 | 1-100 | None |
| A0A0A9EQA2 | 1-47 | None |
| A0A7J0GHS0 | 1-86 | None |
| A0A803JQS2 | 1-89 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.