DPCstruct | MC2248
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 129 ± 18 aa |
| Standard deviation of domain lengths | 18.37 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 84.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 49.26 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| X0KZ10 | 240-387 | IPFKQIPDIVERGFTEIRRLFAKGDQRVLSHYCAAYCCLTDCLEDPLCDLMLILTLTITASSATPEVRPNTKGFSVTTKRRDPALLA… |
| A0A4T0VCR7 | 1-98 | MLDHYQLAMNCLADKMDDALCYVMLPMTFTVCSSSETLEIAPGSRRFSAAAKRESPSQLALVVVTPMMWFLYPVSFPWPKNSGGTAH… |
| A0A428S7E6 | 1100-1231 | None |
| A0A0A1TSS8 | 352-505 | None |
| A0A084QY64 | 80-202 | None |
| X0HT56 | 715-862 | None |
| W9Z7W2 | 107-249 | None |
| A0A2H3FK39 | 157-278 | None |
| A0A420N8S6 | 327-428 | None |
| A0A094G7Y8 | 171-292 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.