DPCstruct | MC22477
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 111 ± 12 aa |
| Standard deviation of domain lengths | 12.07 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 68.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.79 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 35.33 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F1KT92 | 27-111 | KGKKNRAFVKDDRFESVLSDPRFDSLARKDRKVVIDKRFKSMLTNEKFGTKCAVDMRGRRVNVGTANTLGQLYDLDDSTSEKGDS |
| A0A1I7XJS6 | 8-122 | KNLGLADDRFKHLTSDPKFSQLSNINKKVVIGKRFAAALTDARFSSRARVDKRGRRMKKTTGNDLIDLYDIEGNESDSSEDLSVTKK… |
| A0A2D4PS55 | 6-107 | None |
| A0A446M5Q9 | 71-205 | None |
| A0A2H2J4C9 | 1-111 | None |
| A0A6P8SRG6 | 1-111 | None |
| A0A3Q2PJJ6 | 8-120 | None |
| A0A819HCA5 | 1-115 | None |
| A0A1Y3EUM0 | 1-96 | None |
| H3CAM7 | 3-116 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.