DPCstruct | MC22474
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 172 ± 17 aa |
| Standard deviation of domain lengths | 16.78 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 71.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 36.26 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14936 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I7XE86 | 1-178 | MIDDQSVVSRKQSASDLQSRLKTRKLLGVGELARDNGDIYKSKISQLLGINESLYVRLPKGLLYWNSLNTLYFYLIGFLTILVPSVG… |
| A0A2B4SSB5 | 6-180 | KRSFDDAQSRLKCRKLLGIGGKEPSKVLQVLGSHESYFISIPRGYETWQVVVPVFLTVVSIMLMIFPSYCLRALGDSKESTSFAGSL… |
| A0A0N4V1J8 | 1-154 | None |
| D2HJ57 | 474-654 | None |
| F6NXK9 | 1-179 | None |
| A0A4X2KRE5 | 45-225 | None |
| A0A7R9BR46 | 36-248 | None |
| G3TSC7 | 1-144 | None |
| A0A6A5FT64 | 31-191 | None |
| A0A0R3PM27 | 1-152 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.