DPCstruct | MC22472
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 85 ± 6 aa |
| Standard deviation of domain lengths | 5.60 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 88.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 46.46 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6B2LK88 | 80-153 | LDCILSDQTLSYYVLDLMVWKGQMYYDCESEFRFFWAQSKLSEEEGLDEISDRNQLKIVPLPRFGCDKKGLQEA |
| A0A2I0I294 | 69-151 | SYSILDCIFHEPDQTYYAIDMLCWRGYSLYDCTAEFRFFWLNSKLAETGACEPPSQYHRYRFSLVPVYNCDHSGLHAAYTGAA |
| I0Z5Q0 | 45-126 | None |
| A0A6F9DTE1 | 165-246 | None |
| A0A178UGW4 | 3-98 | None |
| H9G8F3 | 73-160 | None |
| A0A2P6QUQ3 | 132-215 | None |
| A0A1V4JD35 | 166-250 | None |
| A0A803SZT1 | 120-207 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.