DPCstruct | MC22471
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 118 ± 12 aa |
| Standard deviation of domain lengths | 12.26 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 78.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 33.92 |
| Pfam Score | 33.33 |
| Assigned Pfam label(s) | CL0016- CL0161 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A822AQJ0 | 6-133 | LRGPPFCMLDLTPKEIIAKIKKPPPLLRPSVSKQVAPPEYINSMKQCWAEQAETRPSFNDLAQSIKLLNGGKKVNIVDTMFKMLEQY… |
| A0A1I7XBZ3 | 3-115 | FKTFSELLYRIKKGGTVPVRPDLSLDGIEVSTALLHLIRDCWNQKPEDRPSSEVICNLLQAMKPNNKSNLMDHVFNMLEDYTSSLEL… |
| A0A3P6TJJ2 | 17-128 | None |
| A0A3R7PBC2 | 344-472 | None |
| A0A1S0TKF1 | 7-142 | None |
| A0A6P9B5R5 | 20-137 | None |
| A0A7R8X180 | 108-226 | None |
| A0A0R3RDT0 | 15-143 | None |
| A0A0M3JIE2 | 14-111 | None |
| A0A016T7T2 | 14-143 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.