DPCstruct | MC22470
Metacluster Properties and Pfam Annotations
| Number of structural domains | 79 |
|---|---|
| Mean domain length (aa) | 155 ± 39 aa |
| Standard deviation of domain lengths | 39.23 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 74.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 34.57 |
| Pfam Score | 89.47 |
| Assigned Pfam label(s) | CL0220- CL0066 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G3Q455 | 1-87 | MTPQNFIESVTMSEPRNKRPWRSLAKQELEKILSETPLVWRGSSKLFRNLRERGIISYTEYLFLLCILTKPHAGFKIAFNMFDADGN |
| A0A1I7XBB4 | 28-164 | YLNFEEENKTKDQIHTKHKLTKRELRFIQFASIEYNDVIYMSPMDFIDSLTLDCPRERVYRRVLNDKDLKQILYRTPPFRCGSKDLF… |
| A0A7M7IJF3 | 591-724 | None |
| A0A0X3NJ32 | 26-184 | None |
| A0A835Q2C3 | 13-144 | None |
| A0A7J7Z693 | 1-132 | None |
| A0A6V7Y5J0 | 822-1059 | None |
| A0A6J2AXU3 | 139-272 | None |
| A0A6V7VS87 | 40-234 | None |
| L8H3D2 | 1-184 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.