DPCstruct | MC2247
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 148 ± 12 aa |
| Standard deviation of domain lengths | 12.21 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 62.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.74 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 34.60 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Z1NPD6 | 1-155 | MAPITADDTVKFLIACITCKEGDKIDFEKVATECEIVSKAAAAKRYERIIKKAKEDDEKQKAQKAVIAEAIANGEEPPAPEETPKKK… |
| A0A093ZJZ7 | 1-136 | MSPATNEEQFRFLISCIRWSNNGKVDFTEVAKECQVVSKGAAAKRYERMMRAHGIHPNGGPGRAPTARQPKTERNAGPSPTKKAKGK… |
| F5HBI8 | 1-152 | None |
| A0A4U0WIT8 | 175-304 | None |
| B6Q8H7 | 4-158 | None |
| A0A553HRC7 | 2-158 | None |
| A0A094B8T1 | 283-417 | None |
| K1WTE4 | 1-167 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.