DPCstruct | MC22469
Metacluster Properties and Pfam Annotations
| Number of structural domains | 215 |
|---|---|
| Mean domain length (aa) | 405 ± 98 aa |
| Standard deviation of domain lengths | 98.37 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 89.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 18.97 |
| Pfam Score | 95.11 |
| Assigned Pfam label(s) | PF00408- CL0754 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A848Q975 | 6-296 | AMISTGGEFTPTPAVSHAILVYNKGRTSGLADGIVITPSHNPPDNGGFKYNPSNGGPADSGITKWVENRANALLEGGLKEVRRMPYA… |
| A0A1I7XAQ4 | 177-597 | SKVQEELMAKVANWLSWDKVCFIHYFIFLIPKKILYLIRFRFAQLAANVFISNGIPVYLFSDVSPTPLVSWATVALKCDAEDNGYKA… |
| M1VMA7 | 224-883 | None |
| M1V875 | 122-708 | None |
| A0A1V2LGQ6 | 43-525 | None |
| U1PBB7 | 12-297 | None |
| A0A1A9XGS3 | 759-1238 | None |
| A0A7R9U9H7 | 147-690 | None |
| A0A3E1K715 | 589-1011 | None |
| A0A1A9X7A2 | 125-484 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.