DPCstruct | MC22468
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 187 ± 35 aa |
| Standard deviation of domain lengths | 34.54 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 70.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 34.35 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7E4VHP2 | 189-343 | PSNIAPSEVEELAVVQKKVLEKYVDKFKKTVDNNSFRSRAKYYDILSVDDLYTRLEKLKCCDPADRRCTYHTCGRRFINLEVLAFHV… |
| A0A2G9UTZ4 | 1-171 | MVIAQKERTLQSDFENESTSLPLIKQRLRRLIGECDIERITCCVPMCGRVFSSVQVLAWHMSYSHHDLGLKSTYGNLCFVCGIRMDS… |
| A0A2G5UF81 | 2-166 | None |
| A0A1I7YEN9 | 1-206 | None |
| A0A0M3IA92 | 25-302 | None |
| F5GU47 | 17-188 | None |
| A0A0N4V6M9 | 83-266 | None |
| A0A0D8XNN4 | 92-269 | None |
| A0A368GIG7 | 233-366 | None |
| A0A0M3J1T0 | 5-216 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.