DPCstruct | MC22465
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 126 ± 13 aa |
| Standard deviation of domain lengths | 13.40 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 71.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 26.59 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00858 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I7X698 | 61-182 | RRYRREIPTRRFEAIEAHCKCVGNLDMECIRFESPPKDDNSKCVCTYDRDMMVAWPCFNMSIWYDHTCPFCTEEGYCEASSINSDVV… |
| A0A0N4XSL8 | 13-126 | VDDLLPKEKSRRKRRDADKGTFEPWNSVCVCEDGECEAEPRKVPTPEDGLCICAFDKLTLDAWPCHPRLIWQNTTCDYCDDHKFCHK… |
| A0A368FIZ5 | 48-200 | None |
| G0P5T5 | 33-182 | None |
| A0A183F9C9 | 3-124 | None |
| A0A1Y3ELX9 | 21-142 | None |
| A0A0B1TCQ7 | 3-135 | None |
| A0A0R3QAK1 | 78-195 | None |
| A0A0B2W4G9 | 183-308 | None |
| A0A183J7B0 | 23-143 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.