DPCstruct | MC22464
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 130 ± 11 aa |
| Standard deviation of domain lengths | 10.75 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 74.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.83 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 51.83 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J1W2D5 | 3-122 | GNVRLWETSLDSLEKSLQEWRTMIGQEDGRPVQITIQRDSGLDVSSPKHGKIDPDNAPHVGGNTWAGGTGGRDTAGLGGKGGPYRLD… |
| A0A1I7X5Y5 | 1-148 | MLTLDTCGGIRSFELSLAGLSTSFSEWKKMIGGNDSVPLRLEIDRKPDDFDIKKLDEPKIGKFDPSNAPHHGGNTWMGGTGGYNTAG… |
| A0A6I9YHN7 | 3-129 | None |
| A0A3M7S582 | 108-240 | None |
| A0A7S2S540 | 452-579 | None |
| A0A5N5SPY1 | 491-619 | None |
| A0A2I0TLY6 | 165-291 | None |
| A0A7S4QQ91 | 45-179 | None |
| A0A5E4CMB8 | 661-787 | None |
| Q19346 | 1394-1527 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.