DPCstruct | MC22463
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 90 ± 9 aa |
| Standard deviation of domain lengths | 8.60 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 86.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 35.53 |
| Pfam Score | 78.03 |
| Assigned Pfam label(s) | CL0016- CL0001- CL0202 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0S7HWS0 | 32-113 | VSVRVFYKTCPLTVRNLATFPDTVTGADTSSLVEVRGSCVNQSEEREEPKMYCGADGEWLVPIGGCLCRSGYEEQGGACKAC |
| A0A1I7X341 | 49-134 | SFKVYYVVCDASTTRFTQYPATVTSSVREDMVKVSGKCVRNAIASQSEPPTGFCTSSGRWNHLIGECACKPGYMGQDIKGEQSCHV |
| A0A0D6MBT0 | 12-108 | None |
| A0A4Z2FR39 | 348-444 | None |
| A0A2R7VSL6 | 63-142 | None |
| A0A132AF98 | 86-171 | None |
| A0A402FGY3 | 333-414 | None |
| A0A498M3X2 | 331-417 | None |
| S4R4K2 | 132-228 | None |
| A0A5B7FJ21 | 16-109 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.