DPCstruct | MC22462
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 93 ± 9 aa |
| Standard deviation of domain lengths | 8.64 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 55.98 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P6NRY6 | 72-170 | LPEQQTEKAEWMTTTCNHALYAICDVFTQYFESLSDVLLDDILSQLYWCVQQDNEQLARSGTNCLENVVILNGEKFNAETWDKTCNC… |
| A0A061A6X8 | 1-97 | MTTTCNHALYAISDVFTQYFETLSDVLLDDILSQLYWCVQQDNEQLARSGTNCLENVVILNGEKFTPEIWDKTCNCMLDIFKTTIPH… |
| A0A820R4H1 | 1-101 | None |
| A0A6V7X798 | 279-358 | None |
| A0A3P7MCN0 | 1-97 | None |
| A0A0C2CGN4 | 2-80 | None |
| A0A6G0YZU7 | 56-153 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.