DPCstruct | MC22460
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 129 ± 10 aa |
| Standard deviation of domain lengths | 10.00 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 69.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 26.53 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF17780 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0N4VWJ4 | 1-133 | MIRDAANEVLHSRVPEGFQWIEAYGQYYSPSCGFFYDPNTGLFYHSDSETYYIFNDDTQQYEIYKCMRKTHWKSRSNKMKAKQLFAG… |
| A0A1I7X074 | 9-133 | MILQTATEVIHSRVPEGFEWIEQYGQYYSRDYGYFYDPNTGLFYHSETQMYYIFNDDTQEYEVYKCMQKSKYYMESPRNILFILLLV… |
| A0A4U5PCK0 | 1-148 | None |
| A0A0N5ABU9 | 7-142 | None |
| A0A4Y2GBE0 | 127-265 | None |
| A0A6P4HV90 | 117-231 | None |
| A0A2A6CBH7 | 17-143 | None |
| A0A267F0J6 | 115-238 | None |
| A0A2H1BXW5 | 79-193 | None |
| A0A0R3SK45 | 90-213 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.