DPCstruct | MC2246
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 693 ± 79 aa |
| Standard deviation of domain lengths | 78.59 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 68.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.37 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 18.72 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P4ZQZ0 | 9-701 | GRLHLNWEADSFNLFRQPSKGENWNPDLLRYCVGILKELLLAMKELNMLGGCCKSFPIFIKRDSSNRVTAADVIFESVWQFVQLLSE… |
| A0A093ZG47 | 266-988 | RIEDVKRLLDERFSSVAKEDFIWLRELREHGYETEEIAQLLLTEQNDSPWIYFEPRDLPREAIIPDHHEAFCVHKGGQEVRHEIKSI… |
| A0A179FQF4 | 336-1055 | None |
| A0A178BJ81 | 510-1186 | None |
| A0A370U1V4 | 42-870 | None |
| A0A1V6TZR6 | 196-839 | None |
| A0A4S9MVC9 | 443-1138 | None |
| A0A1V6RGG4 | 7-632 | None |
| A0A2S7QSN9 | 1-833 | None |
| A0A2J6PF31 | 231-981 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.