DPCstruct | MC22458
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 93 ± 8 aa |
| Standard deviation of domain lengths | 7.91 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 85.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 21.43 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A510JP50 | 37-136 | KIAKTKSISNSEEAYQLVRKSIIKHNLADINCITASEGEDENYYYFDIRSNNEKCGGDPSVAPRLFSYQVNKKTGKLKTDSMQWAEK… |
| A0A561L7C7 | 19-113 | AAQQALTTGDDAAIRASDITRTYGLSKDKSECLLFDTADKGKYFLVRVRENHSDTCGGAAGVSPTLFFLKIRKRNGYTVTTAYDSEH… |
| D4GHK0 | 113-203 | None |
| A0A421BHA5 | 108-207 | None |
| A0A3R8Z072 | 2-83 | None |
| K2J253 | 8-109 | None |
| A0A2U3ES92 | 20-118 | None |
| A0A177G6N5 | 44-130 | None |
| A0A4R3UPG3 | 32-118 | None |
| A0A149VIK3 | 13-98 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.