DPCstruct | MC22452
Metacluster Properties and Pfam Annotations
| Number of structural domains | 508 |
|---|---|
| Mean domain length (aa) | 153 ± 30 aa |
| Standard deviation of domain lengths | 29.92 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 80.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 14.95 |
| Pfam Score | 97.11 |
| Assigned Pfam label(s) | CL0496- CL0128 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2W6E0G7 | 47-188 | RGGRRPGAGQRGSMSVELVVIAPGLIGLLLLVGAGGRVVEAQGHLDGAARDAARAASLAISPAQASQLALQAAQADLGTTSWCAARS… |
| W5XXK7 | 2-93 | AAVFVAAFVSLAGVAVYAAAGVIGIHRAQVAADMASVSAAHEHYVGGDGCAEAAEVIRLNGADLSDCFVEGMDVVVRAEMAGGDAVA… |
| A0A2E4QQZ4 | 9-181 | None |
| A0A534W5R5 | 3-148 | None |
| A0A0M4KJQ0 | 14-179 | None |
| A0A0G3XH86 | 6-150 | None |
| A0A7K3WAR9 | 1-171 | None |
| A0A1X7NRP6 | 3-148 | None |
| A0A3R6X018 | 13-158 | None |
| A0A418WTK6 | 4-180 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.