DPCstruct | MC2245
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 125 ± 12 aa |
| Standard deviation of domain lengths | 11.71 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 72.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.96 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 48.98 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2D3VD02 | 1-111 | MNSSISAEEDWTLLDDPNERRKIQNRIAQRKFRDKIRQQKEDTARQANNERLAAGMYMAPCPEDVETTEETGLPWGSFSMKHVIRTG… |
| A0A093Z9W6 | 1-140 | MSDRREKRDGGSGGKSGSSKGSSKSGSVKTGGKKAQLDDWSGVNEPDERRRIQNRLAQRKFREKAKDQKESRDRDAENQLHAGYAYT… |
| A0A6P8B211 | 36-169 | None |
| F0XMB3 | 91-235 | None |
| A0A2I0S5T8 | 1-116 | None |
| A0A094EWW8 | 165-306 | None |
| A0A1J7IRY9 | 16-129 | None |
| A0A094AGC2 | 423-542 | None |
| R7YSQ6 | 16-131 | None |
| A0A2N3NE19 | 88-212 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.