DPCstruct | MC22448
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 455 ± 86 aa |
| Standard deviation of domain lengths | 86.35 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 87.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 15.73 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1W9LEX4 | 117-524 | VVRRSFERVFQAAEARYRVEAAAGRPVANRRVTLRNLDATAAAVFHLRGAGWPDLSSTEGILGSILPPGADEERKALAIWKFLVDWR… |
| A0A7Y5PU60 | 10-544 | CCAETIVESFSPGQPKVWQMPLAAPSRLETLTVTNRGSHPVTQVIVREANRDWSSSGAILDTILKDKHPADDREKALGIYQYVQDYI… |
| A0A0S7Y5K3 | 25-522 | None |
| A0A1V1PI74 | 57-436 | None |
| A0A7X7IXE2 | 190-615 | None |
| A0A2U3QDM6 | 78-550 | None |
| A0A7C3IPW5 | 1-524 | None |
| A0A7C3J247 | 19-544 | None |
| A0A354GPD6 | 5-536 | None |
| A0A1F5Z010 | 5-579 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.