DPCstruct | MC22443
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 55 ± 11 aa |
| Standard deviation of domain lengths | 10.68 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 76.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 46.38 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y2H9Z3 | 1-39 | MCMPVECPLCHKTTWKGCGQHIDSVMSKLTEDQKCKCPR |
| A0A5C3F459 | 3-49 | TATDKLVDSCFAVQCDKCGKTTWKGCGKHIDSVMSQVPPEQRCTCPR |
| A0A080YYN1 | 1-67 | None |
| A0A2A9P8K2 | 10-79 | None |
| A4S1Y0 | 1-41 | None |
| R9P726 | 80-132 | None |
| W2PEM3 | 19-81 | None |
| A0A507CZE5 | 190-241 | None |
| A0A3R7IXK6 | 1-44 | None |
| M4B7E5 | 11-46 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.