DPCstruct | MC2244
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 133 ± 11 aa |
| Standard deviation of domain lengths | 11.31 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 70.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.74 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 41.67 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06741 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| N1RB60 | 5-139 | AVFSSKNYLILGAIGGRAAFRTDTAISKNRFGNERVLQPWVPDSNDTFNGGLEKSSGSGNWDQFAENERLFGLKTNYDENFYTTAID… |
| A0A139AWA6 | 122-250 | VDIPGLEKDDSFLTDTAISSSALQASSSAQRELKPWVPPSIDSSDLTIPGSSADDDLLTSPSATSPTAQTRWDQFAVNERLFGVTTD… |
| A0A2P2MIY6 | 1-117 | None |
| A0A5N5PVP7 | 40-186 | None |
| A0A6S7NA56 | 328-445 | None |
| A0A2T0FH27 | 150-284 | None |
| M7S613 | 23-169 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.