DPCstruct | MC22437
Metacluster Properties and Pfam Annotations
| Number of structural domains | 84 |
|---|---|
| Mean domain length (aa) | 89 ± 13 aa |
| Standard deviation of domain lengths | 13.46 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 87.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 30.24 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W1KTV2 | 1-85 | MDKEDFDGLMEGMREAAADIKARRAAKVKAIRAKTQLSQPAFAARYHLSVRTLQNWESGKAIDSVGETLLTLIDRDPDTVARLLN |
| A0A136P1N9 | 6-89 | TSLEHALSDLQEIRAGKKQPSRITYYQIPDAKEIRNKMGMSQAKFALMLGISQRTLEGWEQGRRRPKGPARRLLEVAQNFPEAV |
| A0A534ZGX4 | 4-95 | None |
| A0A2V9GQM7 | 24-121 | None |
| A0A0W0UNZ3 | 19-121 | None |
| A0A229FT02 | 31-116 | None |
| A0A2T2UTH4 | 10-99 | None |
| A0A537LA72 | 3-98 | None |
| A0A2M9F0I1 | 1-83 | None |
| A0A509EIT7 | 12-116 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.