DPCstruct | MC22435
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 118 ± 11 aa |
| Standard deviation of domain lengths | 10.80 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 88.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 32.97 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A495CJX2 | 58-174 | DGHFMGPGMAWPELLSTARQSATEGVVDSDARLVLLFPTLGDARLPDDAPVALTIALGALTLIEEPAEVASMLLENQGQWAPAHWRL… |
| A0A328NUT5 | 105-229 | LANVGGHEFRPGLSWPELVAAANWSGAPYGVVKPHARLLLLLPALGDADLPSEAMAIVTVALTGCGAGPRAGELVEWLLQEPQRWPH… |
| A0A317D8B8 | 124-217 | None |
| A0A7W7H4L4 | 259-386 | None |
| A0A561W535 | 196-314 | None |
| A0A3D9QTJ3 | 1-127 | None |
| A0A428XRL5 | 118-233 | None |
| A0A561VMV5 | 1-109 | None |
| A0A3T1B3G8 | 88-195 | None |
| A0A365HCK5 | 105-221 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.