DPCstruct | MC22434
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 74 ± 4 aa |
| Standard deviation of domain lengths | 4.18 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 89.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 37.07 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06855 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A351TKZ1 | 3-74 | SFRKWMEQYKEECSPIGDLARDIAADDTFPKSSNADILFAYMEECGACESCYKVFYEAWGMYERERVGEKLY |
| A0A4R8H2M2 | 1-75 | MPKQQSFTTWLQTHSKDRTAIGDLARDVSADPGWPSGKGLSGQRAYLEDLGAIPAAIDTLERAWEAYTAHRAAED |
| A0A5P1ZPD7 | 43-112 | None |
| A0A1N7AIF5 | 32-110 | None |
| A0A515YE46 | 133-207 | None |
| A0A0P7K772 | 16-86 | None |
| A0A4Q6EAN4 | 232-305 | None |
| A0A1K2ISQ2 | 54-132 | None |
| A0A544U7D2 | 1-67 | None |
| A0A6V8KFA9 | 85-158 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.